BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0477 (697 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 7.0 EF588468-1|ABQ96704.1| 176|Anopheles gambiae transposase protein. 23 9.2 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 492 FLLQRQCFSKYDRVPIRRFIVALLRLTSALNLINNFY 382 +L+Q + +S + I F LRL+S L++ FY Sbjct: 287 YLVQYEKYSPLFVIKISLFRTVFLRLSSLAVLLSRFY 323 >EF588468-1|ABQ96704.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 9.2 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 215 SEILEILKTYLITDLSCKTTREVILTNTINFVLLFYT 105 SE ++L L+ DL CK L + NF FYT Sbjct: 101 SETKKVLDRMLL-DLICKECLPFNLVESENFKKFFYT 136 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 655,889 Number of Sequences: 2352 Number of extensions: 13174 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -