BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0477 (697 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51995-7|AAA96075.1| 191|Caenorhabditis elegans Hypothetical pr... 29 3.2 AF067609-5|AAC17534.1| 644|Caenorhabditis elegans Hypothetical ... 27 9.7 >U51995-7|AAA96075.1| 191|Caenorhabditis elegans Hypothetical protein F07G6.2 protein. Length = 191 Score = 29.1 bits (62), Expect = 3.2 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 6/76 (7%) Frame = +1 Query: 1 YRPRNPLYTKFYENR*SRFRDSD------YIYVHTRIARLKV*NNNTKLIVFVKITSRVV 162 +RP P Y +NR +R +D + + T + +++ N+ T+L+ + VV Sbjct: 68 FRPSTPEYPMTSQNRFARMLQTDIVTANNFTFTSTTTSAVELVNSTTRLVPTPTSSIPVV 127 Query: 163 LHERSVIKYVFKISNI 210 H++ VI KI+N+ Sbjct: 128 DHKKDVIA-TMKIANL 142 >AF067609-5|AAC17534.1| 644|Caenorhabditis elegans Hypothetical protein C23H5.7 protein. Length = 644 Score = 27.5 bits (58), Expect = 9.7 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -1 Query: 124 LYYYFIPLNEQFWYVHIYNLNLGNGFNDF 38 L Y+++P N +++Y+ + ++ G +N F Sbjct: 36 LLYFYVPFNSKYYYIWSFFVSFGVMYNMF 64 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,653,657 Number of Sequences: 27780 Number of extensions: 288397 Number of successful extensions: 678 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 678 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -