BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0477 (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 4.8 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 22 6.4 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 22 6.4 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 22 6.4 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 22 6.4 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 22 6.4 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.2 bits (45), Expect = 4.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 555 ETLIID*NR*LFSYYKCLNVFFLLQRQCFSKYDR 454 + LI+ + FS+Y+ NVF Q +YDR Sbjct: 267 DDLILTLGKKEFSHYEHQNVFVKNSGQWLREYDR 300 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 Query: 162 NYPRSNFNKYYQFCIIILYL 103 NY N N Y Q C I Y+ Sbjct: 90 NYSNYNNNNYKQLCYNINYI 109 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 Query: 162 NYPRSNFNKYYQFCIIILYL 103 NY N N Y Q C I Y+ Sbjct: 90 NYSNYNNNNYKQLCYNINYI 109 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 Query: 162 NYPRSNFNKYYQFCIIILYL 103 NY N N Y Q C I Y+ Sbjct: 90 NYSNYNNNNYKQLCYNINYI 109 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 Query: 162 NYPRSNFNKYYQFCIIILYL 103 NY N N Y Q C I Y+ Sbjct: 90 NYSNYNNNNYKQLCYNINYI 109 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 Query: 162 NYPRSNFNKYYQFCIIILYL 103 NY N N Y Q C I Y+ Sbjct: 90 NYSNYNNNNYKQLCYNINYI 109 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,910 Number of Sequences: 438 Number of extensions: 3637 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -