BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0476 (699 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88314-1|AAF99885.1| 342|Caenorhabditis elegans Hypothetical pr... 29 4.2 Z68000-4|CAA91972.4| 1342|Caenorhabditis elegans Hypothetical pr... 28 7.4 Z50739-4|CAA90605.4| 1342|Caenorhabditis elegans Hypothetical pr... 28 7.4 >U88314-1|AAF99885.1| 342|Caenorhabditis elegans Hypothetical protein C46H11.6 protein. Length = 342 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -3 Query: 208 ENINDFIYCSTDGRQVGRLSISIIFEVASSIVKF-PINRFQNGIGSSNKIIKL 53 E +N + D + VG+ + +I +S+V F N F NG+ S+KI+K+ Sbjct: 26 ETVNMTVSFKIDEKDVGKPANEVIRINENSMVSFLSTNSFYNGLILSDKIVKV 78 >Z68000-4|CAA91972.4| 1342|Caenorhabditis elegans Hypothetical protein F13D2.1 protein. Length = 1342 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -2 Query: 155 VKHFDHF*SSKLDCQVSNKSIPKRYR 78 + H D F S DCQ N +I RYR Sbjct: 1317 LNHMDRFEESSYDCQNLNSAITIRYR 1342 >Z50739-4|CAA90605.4| 1342|Caenorhabditis elegans Hypothetical protein F13D2.1 protein. Length = 1342 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -2 Query: 155 VKHFDHF*SSKLDCQVSNKSIPKRYR 78 + H D F S DCQ N +I RYR Sbjct: 1317 LNHMDRFEESSYDCQNLNSAITIRYR 1342 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,399,768 Number of Sequences: 27780 Number of extensions: 243814 Number of successful extensions: 385 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -