BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0474 (696 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0795 + 27783813-27785246,27785339-27785591,27786377-27786639 31 1.2 >03_05_0795 + 27783813-27785246,27785339-27785591,27786377-27786639 Length = 649 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +2 Query: 185 DIHL*N*MNSQIVRVQFARPHRGPQYNPQLDRE--SPLGFMASPEDG*RAETLKLIKFA 355 ++H+ +NS IV H GP Y+ + S + F+ASP D ++T+ ++ FA Sbjct: 483 ELHVICGLNSHIVNYTMFGRHYGPGYSRHRSKSQYSHVNFLASPRDLHSSQTVPILFFA 541 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,147,849 Number of Sequences: 37544 Number of extensions: 267820 Number of successful extensions: 486 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -