Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0474
         (696 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_9939| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   2.7  
SB_7465| Best HMM Match : RHH_1 (HMM E-Value=6.7)                      28   8.3  

>SB_9939| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 87

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 12/41 (29%), Positives = 24/41 (58%)
 Frame = +3

Query: 468 LTKCILLAQASAISKIHIFASSYLMPCTILDSISFKDFAAL 590
           LT  IL +Q   + ++ ++ S+YL+   +L+    K+F+ L
Sbjct: 36  LTTTILSSQGGRLRELQLYLSNYLLYTCVLEKCQHKEFSLL 76


>SB_7465| Best HMM Match : RHH_1 (HMM E-Value=6.7)
          Length = 71

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = +1

Query: 1  RYQAYRYRRPR 33
          +YQAYRYRRPR
Sbjct: 57 KYQAYRYRRPR 67


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,402,661
Number of Sequences: 59808
Number of extensions: 327043
Number of successful extensions: 1105
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1082
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1105
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1817559367
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)