BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0472 (700 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP23A10.06 |||manganese ion transporter |Schizosaccharomyces p... 28 1.1 SPCC31H12.06 |mug111||sequence orphan|Schizosaccharomyces pombe|... 25 7.9 >SPBP23A10.06 |||manganese ion transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 335 Score = 28.3 bits (60), Expect = 1.1 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -3 Query: 674 YFKTYV*SILFLIQRPSVRCFNTSVCMKPLVVNFNLG 564 Y+ +Y LFL+ PS++ F++S K L +NF G Sbjct: 217 YWWSYERIRLFLLGHPSLQAFSSSQSTKDLYINFVSG 253 >SPCC31H12.06 |mug111||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 468 Score = 25.4 bits (53), Expect = 7.9 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +3 Query: 66 LLCLY*FSMHFFRSYVCVCMMILLSANLRL 155 ++CL S +FF +C+C++ +S+ L L Sbjct: 436 IVCLKYCSFYFFIGPICICLLGSISSYLLL 465 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,812,808 Number of Sequences: 5004 Number of extensions: 58440 Number of successful extensions: 143 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 143 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -