BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0472 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1519 + 27390204-27390590,27390591-27390809,27392516-273929... 29 2.7 09_04_0522 + 18306085-18306125,18307142-18307862,18308054-183081... 28 8.2 >07_03_1519 + 27390204-27390590,27390591-27390809,27392516-27392962, 27393076-27393274,27393372-27393456,27393566-27393998 Length = 589 Score = 29.5 bits (63), Expect = 2.7 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 5/64 (7%) Frame = +3 Query: 282 KNIITKKKPHLFEERERESENTLYCKPTQFTL---KKKIACVQFTRVRSETFKKLK--YN 446 KNII L EE +E E L + + + KKK+AC F + RS FKK++ N Sbjct: 15 KNIIAVGLDDLTEEDRQELERELKHELEEEKMERTKKKLAC--FQKTRSGAFKKVRSEVN 72 Query: 447 YPKC 458 P C Sbjct: 73 KPIC 76 >09_04_0522 + 18306085-18306125,18307142-18307862,18308054-18308186, 18308458-18308534,18308573-18308632 Length = 343 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -2 Query: 693 RMLSSYIL*NIRIKYFIFNTAPICEM 616 RM++SY+ + I +++F + PIC + Sbjct: 315 RMITSYLRDQVAISFYMFRSDPICNI 340 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,313,388 Number of Sequences: 37544 Number of extensions: 276431 Number of successful extensions: 445 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -