BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0472 (700 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071625-1|AAL49247.1| 682|Drosophila melanogaster RE67475p pro... 34 0.21 AE014134-2918|AAF53658.2| 682|Drosophila melanogaster CG7180-PA... 34 0.21 >AY071625-1|AAL49247.1| 682|Drosophila melanogaster RE67475p protein. Length = 682 Score = 33.9 bits (74), Expect = 0.21 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 5/83 (6%) Frame = -2 Query: 261 WFFVKLQKCRSKQITCQP----SNYVFLEQNRYLHTKFFTVLNLHSTIS-SYTHTRNYEK 97 W V Q+C + + CQP Y N+ K+ V ++H +S SYT+ + +E Sbjct: 488 WSLVYDQECSAVVVLCQPPSQSQQYPSFWPNKSKMEKYGPVFSVHYVMSKSYTNIKQWE- 546 Query: 96 NALKISTNIIIHSEYLKRLLAPT 28 KI+ I+ +E + + APT Sbjct: 547 --FKINKKIVSLTEMMAGVKAPT 567 >AE014134-2918|AAF53658.2| 682|Drosophila melanogaster CG7180-PA protein. Length = 682 Score = 33.9 bits (74), Expect = 0.21 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 5/83 (6%) Frame = -2 Query: 261 WFFVKLQKCRSKQITCQP----SNYVFLEQNRYLHTKFFTVLNLHSTIS-SYTHTRNYEK 97 W V Q+C + + CQP Y N+ K+ V ++H +S SYT+ + +E Sbjct: 488 WSLVYDQECSAVVVLCQPPSQSQQYPSFWPNKSKMEKYGPVFSVHYVMSKSYTNIKQWE- 546 Query: 96 NALKISTNIIIHSEYLKRLLAPT 28 KI+ I+ +E + + APT Sbjct: 547 --FKINKKIVSLTEMMAGVKAPT 567 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,793,499 Number of Sequences: 53049 Number of extensions: 546864 Number of successful extensions: 1072 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1052 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1072 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3067209849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -