BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0469 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0137 + 988442-988641,989088-989281,989369-989488,989594-98... 29 4.7 07_03_1545 - 27599605-27599859,27600012-27600123,27600216-27600478 28 8.2 >02_01_0137 + 988442-988641,989088-989281,989369-989488,989594-989673, 990244-990510,990840-992458,992571-993327,993560-995506 Length = 1727 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 237 KAIHNV*RFKKTHLYVSLPQVLMSLIHYLHKLCKEPKR 350 K I N+ +K + Q L+ +LH LCKE KR Sbjct: 790 KIIQNIRSLQKLRTLMFFGQNNTMLLRFLHTLCKESKR 827 >07_03_1545 - 27599605-27599859,27600012-27600123,27600216-27600478 Length = 209 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/45 (24%), Positives = 24/45 (53%) Frame = +3 Query: 276 LYVSLPQVLMSLIHYLHKLCKEPKRKIR*TSKIIWLKMVLNPPIL 410 LY +P++ + ++++ +LCK +R K + ++ PP L Sbjct: 38 LYEDVPEMPLMALNHISRLCKSIDASVRFYVKALGFVLIHRPPAL 82 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,715,329 Number of Sequences: 37544 Number of extensions: 274769 Number of successful extensions: 555 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -