BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0466 (699 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 46 1e-06 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 42 1e-05 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 42 2e-05 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 42 2e-05 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 42 2e-05 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 42 2e-05 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 42 2e-05 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 42 2e-05 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 42 2e-05 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 42 2e-05 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 42 2e-05 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 42 2e-05 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 42 2e-05 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 41 4e-05 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 25 2.3 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 24 5.3 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 24 5.3 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 24 5.3 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 23 7.0 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 7.0 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 23 7.0 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 7.0 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 46.0 bits (104), Expect = 1e-06 Identities = 20/36 (55%), Positives = 25/36 (69%) Frame = +3 Query: 9 GSVVRGGYSLIQPDGYIREVKYVADDLTGFNAVVKK 116 G VV+G YS++ PDG R V Y AD GFNAVV++ Sbjct: 46 GDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAVVRR 81 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 42.3 bits (95), Expect = 1e-05 Identities = 33/82 (40%), Positives = 42/82 (51%), Gaps = 2/82 (2%) Frame = +3 Query: 9 GSVVRGGYSLIQPDGYIREVKYVADDLTGFNAVVKKFLPVNVEKKIEQHEKSHPDPPCHE 188 G V G YSL+ DG+ R V Y AD TGFNAVV++ P V KI Q P H+ Sbjct: 107 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR-EPSAV--KIAQ--------PVHK 155 Query: 189 VKNEQLKVETKTEHS--ESHHA 248 V + + V H+ + HHA Sbjct: 156 VIAQPVHVHAPVAHATVQHHHA 177 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 41.5 bits (93), Expect = 2e-05 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +3 Query: 9 GSVVRGGYSLIQPDGYIREVKYVADDLTGFNAVVKK 116 G V G YSL+ DG+ R V Y AD TGFNAVV++ Sbjct: 115 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 41.5 bits (93), Expect = 2e-05 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +3 Query: 9 GSVVRGGYSLIQPDGYIREVKYVADDLTGFNAVVKK 116 G V G YSL+ DG+ R V Y AD TGFNAVV++ Sbjct: 107 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 41.5 bits (93), Expect = 2e-05 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +3 Query: 9 GSVVRGGYSLIQPDGYIREVKYVADDLTGFNAVVKK 116 G V G YSL+ DG+ R V Y AD TGFNAVV++ Sbjct: 107 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 41.5 bits (93), Expect = 2e-05 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +3 Query: 9 GSVVRGGYSLIQPDGYIREVKYVADDLTGFNAVVKK 116 G V G YSL+ DG+ R V Y AD TGFNAVV++ Sbjct: 115 GDEVHGQYSLLDSDGHHRIVDYHADHHTGFNAVVRR 150 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 41.5 bits (93), Expect = 2e-05 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +3 Query: 9 GSVVRGGYSLIQPDGYIREVKYVADDLTGFNAVVKK 116 G V G YSL+ DG+ R V Y AD TGFNAVV++ Sbjct: 107 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 41.5 bits (93), Expect = 2e-05 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +3 Query: 9 GSVVRGGYSLIQPDGYIREVKYVADDLTGFNAVVKK 116 G V G YSL+ DG+ R V Y AD TGFNAVV++ Sbjct: 115 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 41.5 bits (93), Expect = 2e-05 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +3 Query: 9 GSVVRGGYSLIQPDGYIREVKYVADDLTGFNAVVKK 116 G V G YSL+ DG+ R V Y AD TGFNAVV++ Sbjct: 139 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 174 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 41.5 bits (93), Expect = 2e-05 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +3 Query: 9 GSVVRGGYSLIQPDGYIREVKYVADDLTGFNAVVKK 116 G V G YSL+ DG+ R V Y AD TGFNAVV++ Sbjct: 107 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 41.5 bits (93), Expect = 2e-05 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +3 Query: 9 GSVVRGGYSLIQPDGYIREVKYVADDLTGFNAVVKK 116 G V G YSL+ DG+ R V Y AD TGFNAVV++ Sbjct: 115 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 41.5 bits (93), Expect = 2e-05 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +3 Query: 9 GSVVRGGYSLIQPDGYIREVKYVADDLTGFNAVVKK 116 G V G YSL+ DG+ R V Y AD TGFNAVV++ Sbjct: 107 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 41.5 bits (93), Expect = 2e-05 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +3 Query: 9 GSVVRGGYSLIQPDGYIREVKYVADDLTGFNAVVKK 116 G V G YSL+ DG+ R V Y AD TGFNAVV++ Sbjct: 115 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 40.7 bits (91), Expect = 4e-05 Identities = 20/35 (57%), Positives = 23/35 (65%) Frame = +3 Query: 9 GSVVRGGYSLIQPDGYIREVKYVADDLTGFNAVVK 113 G V G YSL+ DG+ R V Y AD TGFNAVV+ Sbjct: 107 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 141 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 25.0 bits (52), Expect = 2.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -1 Query: 246 HDDSHCVLFWFLPLIVHFSLHGTVGLDAIFRVA 148 H D H +FW+ PL+ + V D + + A Sbjct: 336 HQDPHRNIFWWSPLLARLRNNCEVARDRMLQTA 368 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 23.8 bits (49), Expect = 5.3 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +1 Query: 484 PRIIKRRTPAEEHHV-EPSKHEALH 555 P I RR+P HHV EP A H Sbjct: 130 PLTIHRRSPGVPHHVPEPQHMGATH 154 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.8 bits (49), Expect = 5.3 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +1 Query: 484 PRIIKRRTPAEEHHV-EPSKHEALH 555 P I RR+P HHV EP A H Sbjct: 130 PLTIHRRSPGVPHHVPEPQHMGATH 154 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.8 bits (49), Expect = 5.3 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 246 HDDSHCVLFWFLPLI 202 H D H LFW+ PL+ Sbjct: 279 HSDPHRDLFWWTPLL 293 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 484 PRIIKRRTPAEEHHVEPSKH 543 P I RR+P HHV +H Sbjct: 154 PLTIHRRSPGVPHHVAEPQH 173 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 484 PRIIKRRTPAEEHHVEPSKH 543 P I RR+P HHV +H Sbjct: 154 PLTIHRRSPGVPHHVAEPQH 173 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 23.4 bits (48), Expect = 7.0 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 Query: 595 VRFLLHVQYAPVR 557 VR+LLH +Y P R Sbjct: 429 VRYLLHARYGPAR 441 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -2 Query: 473 IILLRVHCVLREVLQQRLHGGLPHYVFLRV 384 + LL V C LRE LP Y+F R+ Sbjct: 74 VTLLLVFCGLREADVCAFDNILPDYIFFRM 103 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 490,836 Number of Sequences: 2352 Number of extensions: 8363 Number of successful extensions: 33 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -