BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0466 (699 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 23 2.1 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 8.5 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 23.4 bits (48), Expect = 2.1 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = +3 Query: 15 VVRGGYSLIQPDGYIREVKYVADD----LTGFNAVVKKFLPVNVEKKIEQHEKSHPD 173 V +G S PDG + YVAD+ + G + +P +++ +E + +HP+ Sbjct: 70 VSQGSDSYTAPDGQQVSITYVADENGFQVQGSHIPTAPPIPPEIQRALEWN-AAHPE 125 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = -1 Query: 231 CVLFWFLPLIVHFSLHGTVGL 169 C+LF+ +P++ L+ +GL Sbjct: 210 CILFFLIPMVFIAVLYIRIGL 230 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,678 Number of Sequences: 438 Number of extensions: 2205 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -