BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0465 (697 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY333285-1|AAR03490.1| 1943|Homo sapiens truncated transient rec... 31 3.0 AY333284-1|AAR03489.1| 2017|Homo sapiens transient receptor pote... 31 3.0 AY333283-1|AAR03488.1| 2017|Homo sapiens transient receptor pote... 31 3.0 AY333282-1|AAR03487.1| 2022|Homo sapiens transient receptor pote... 31 3.0 AL354795-2|CAH70894.1| 2022|Homo sapiens transient receptor pote... 31 3.0 AL354795-1|CAH70893.1| 1133|Homo sapiens transient receptor pote... 31 3.0 AK026281-1|BAB15429.1| 1133|Homo sapiens protein ( Homo sapiens ... 31 3.0 AF448232-1|AAM21562.1| 2022|Homo sapiens LTRPC6 channel kinase 2... 31 3.0 AF350881-1|AAK31202.2| 2022|Homo sapiens channel-kinase 2 protein. 31 3.0 >AY333285-1|AAR03490.1| 1943|Homo sapiens truncated transient receptor potential cation channel subfamily M member 6 vari protein. Length = 1943 Score = 31.5 bits (68), Expect = 3.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 409 DNYTVVPTAYNKPYRYIPVW*SQHASIILRECCCLFSDHSQKE 281 + Y + T + KP+ P+ H ++LR CC + H Q+E Sbjct: 1087 NRYRYIMTYHEKPWLPPPLILLSHVGLLLRRLCCHRAPHDQEE 1129 >AY333284-1|AAR03489.1| 2017|Homo sapiens transient receptor potential cation channel subfamily M member 6 variant c protein. Length = 2017 Score = 31.5 bits (68), Expect = 3.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 409 DNYTVVPTAYNKPYRYIPVW*SQHASIILRECCCLFSDHSQKE 281 + Y + T + KP+ P+ H ++LR CC + H Q+E Sbjct: 1082 NRYRYIMTYHEKPWLPPPLILLSHVGLLLRRLCCHRAPHDQEE 1124 >AY333283-1|AAR03488.1| 2017|Homo sapiens transient receptor potential cation channel subfamily M member 6 variant b protein. Length = 2017 Score = 31.5 bits (68), Expect = 3.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 409 DNYTVVPTAYNKPYRYIPVW*SQHASIILRECCCLFSDHSQKE 281 + Y + T + KP+ P+ H ++LR CC + H Q+E Sbjct: 1082 NRYRYIMTYHEKPWLPPPLILLSHVGLLLRRLCCHRAPHDQEE 1124 >AY333282-1|AAR03487.1| 2022|Homo sapiens transient receptor potential cation channel subfamily M member 6 variant a protein. Length = 2022 Score = 31.5 bits (68), Expect = 3.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 409 DNYTVVPTAYNKPYRYIPVW*SQHASIILRECCCLFSDHSQKE 281 + Y + T + KP+ P+ H ++LR CC + H Q+E Sbjct: 1087 NRYRYIMTYHEKPWLPPPLILLSHVGLLLRRLCCHRAPHDQEE 1129 >AL354795-2|CAH70894.1| 2022|Homo sapiens transient receptor potential cation channel, subfamily M, member 6 protein. Length = 2022 Score = 31.5 bits (68), Expect = 3.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 409 DNYTVVPTAYNKPYRYIPVW*SQHASIILRECCCLFSDHSQKE 281 + Y + T + KP+ P+ H ++LR CC + H Q+E Sbjct: 1087 NRYRYIMTYHEKPWLPPPLILLSHVGLLLRRLCCHRAPHDQEE 1129 >AL354795-1|CAH70893.1| 1133|Homo sapiens transient receptor potential cation channel, subfamily M, member 6 protein. Length = 1133 Score = 31.5 bits (68), Expect = 3.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 409 DNYTVVPTAYNKPYRYIPVW*SQHASIILRECCCLFSDHSQKE 281 + Y + T + KP+ P+ H ++LR CC + H Q+E Sbjct: 750 NRYRYIMTYHEKPWLPPPLILLSHVGLLLRRLCCHRAPHDQEE 792 >AK026281-1|BAB15429.1| 1133|Homo sapiens protein ( Homo sapiens cDNA: FLJ22628 fis, clone HSI06177. ). Length = 1133 Score = 31.5 bits (68), Expect = 3.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 409 DNYTVVPTAYNKPYRYIPVW*SQHASIILRECCCLFSDHSQKE 281 + Y + T + KP+ P+ H ++LR CC + H Q+E Sbjct: 750 NRYRYIMTYHEKPWLPPPLILLSHVGLLLRRLCCHRAPHDQEE 792 >AF448232-1|AAM21562.1| 2022|Homo sapiens LTRPC6 channel kinase 2 protein. Length = 2022 Score = 31.5 bits (68), Expect = 3.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 409 DNYTVVPTAYNKPYRYIPVW*SQHASIILRECCCLFSDHSQKE 281 + Y + T + KP+ P+ H ++LR CC + H Q+E Sbjct: 1087 NRYRYIMTYHEKPWLPPPLILLSHVGLLLRRLCCHRAPHDQEE 1129 >AF350881-1|AAK31202.2| 2022|Homo sapiens channel-kinase 2 protein. Length = 2022 Score = 31.5 bits (68), Expect = 3.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 409 DNYTVVPTAYNKPYRYIPVW*SQHASIILRECCCLFSDHSQKE 281 + Y + T + KP+ P+ H ++LR CC + H Q+E Sbjct: 1087 NRYRYIMTYHEKPWLPPPLILLSHVGLLLRRLCCHRAPHDQEE 1129 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,922,613 Number of Sequences: 237096 Number of extensions: 1992472 Number of successful extensions: 2278 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2198 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2269 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8007229802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -