BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0456 (697 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe... 78 1e-15 >SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 273 Score = 78.2 bits (184), Expect = 1e-15 Identities = 33/68 (48%), Positives = 44/68 (64%) Frame = +1 Query: 487 IRILFYYLQAYEYIEASFTIADRIYGSTFFIATGFHGIHVIIGTLFLLICYIRHLNNHFS 666 + LF QAYEY A FTI+D +YG++F+ ATG HGIH+I+GT+ LL+ H + Sbjct: 181 LSFLFLGGQAYEYWNAPFTISDSVYGASFYFATGLHGIHIIVGTILLLVATYNIYTYHLT 240 Query: 667 KNHHFGFE 690 HH GFE Sbjct: 241 NTHHNGFE 248 Score = 65.7 bits (153), Expect = 6e-12 Identities = 32/73 (43%), Positives = 45/73 (61%), Gaps = 2/73 (2%) Frame = +2 Query: 290 HRRLSPNIEIGRI*PPSRITP--FNPFQIPLLNTIILIRSGVTVT*AHHSLIENNFSQTK 463 H LSP E+G + PP I +P ++PLLNT+IL+ SG ++T AH+SLI N Sbjct: 113 HSSLSPTFELGAVWPPVGIADKTIDPLEVPLLNTVILLTSGASLTYAHYSLIARNRENAL 172 Query: 464 QRLFLTILLGFYF 502 + L++TI L F F Sbjct: 173 KGLYMTIALSFLF 185 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 159 RDISREGTYQGKHTILVNKGLR*G 230 RD+S E G HT V KGL+ G Sbjct: 69 RDMSTEANIHGAHTKAVTKGLKIG 92 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,141,764 Number of Sequences: 5004 Number of extensions: 34752 Number of successful extensions: 80 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -