BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0452 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasm... 25 2.3 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 7.0 >DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasmic carbonic anhydrase protein. Length = 276 Score = 25.0 bits (52), Expect = 2.3 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +2 Query: 386 TANYPLEVVKSLPKGLEPGVYYGWAQVDTGPVYEMVANIGWVLF 517 T N PL+ + LP+G Y G + T P E V W+LF Sbjct: 176 TLNKPLDPARLLPEGKAYWTYLG--SLTTPPCSESVT---WILF 214 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 681 FFISSRICSMRASQTIEVLLSPQ 613 FF + +C M++ E+LL+PQ Sbjct: 119 FFNNYNLCHMKSINWEEILLAPQ 141 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,035 Number of Sequences: 2352 Number of extensions: 14612 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -