BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0451 (396 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0931 - 22708167-22709093 27 5.5 08_02_0266 + 15051868-15052286,15052376-15052475,15053540-150535... 26 9.6 >08_02_0931 - 22708167-22709093 Length = 308 Score = 27.1 bits (57), Expect = 5.5 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 244 HWVFQLTIRXSNISTTLRFIEKTCFTTSITRS 149 HW+ QL + S +ST+ + F ++ RS Sbjct: 157 HWLLQLVVTASLVSTSATVVLPRSFAVAVVRS 188 >08_02_0266 + 15051868-15052286,15052376-15052475,15053540-15053581, 15053734-15053930,15055412-15055508,15055604-15055699, 15056395-15056633,15056728-15056811,15056898-15057185, 15057658-15057718,15061093-15061362,15061663-15061722 Length = 650 Score = 26.2 bits (55), Expect = 9.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 128 THLLQKLGSCN*SCETRFLNK 190 TH+ + G+C SC+TR NK Sbjct: 561 THISSQAGTCIASCQTRMNNK 581 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,054,812 Number of Sequences: 37544 Number of extensions: 124944 Number of successful extensions: 154 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 684860244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -