BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0450 (724 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0706 + 27419215-27419371,27419521-27419734,27419818-274199... 31 0.93 >04_04_0706 + 27419215-27419371,27419521-27419734,27419818-27419913, 27420006-27420123,27420211-27420384,27420633-27420803, 27420932-27420987,27421125-27421214,27421296-27421444, 27421640-27421722,27421830-27421958,27422063-27422137, 27422248-27422416,27422965-27423104,27423191-27423298, 27423603-27423783,27424445-27424542,27424639-27424728, 27424881-27425034,27425376-27425431,27425483-27425533, 27425651-27425732,27425821-27425995,27426748-27426823, 27426951-27427121,27427198-27427269,27427350-27427454, 27427948-27428037,27428703-27428908,27428989-27429190, 27429294-27429473,27429858-27429925,27430005-27430341, 27430428-27430637,27430765-27431448,27431537-27431940, 27432495-27432542,27432777-27433023,27433381-27433602, 27433796-27434026 Length = 2122 Score = 31.1 bits (67), Expect = 0.93 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 185 RFLNNINNTDTLMVLVLSRHDTNTALLITVL*IKNGSTAFRFNKTVRDRLAP 340 R+L ++ N D L++ L HDT+T + I L I G++ + F V+ AP Sbjct: 122 RYLVHVYNLDELLLCALPYHDTHTFVRIVQL-INLGNSKWAFLDAVKSSGAP 172 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,124,091 Number of Sequences: 37544 Number of extensions: 273764 Number of successful extensions: 420 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 420 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -