BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0447 (691 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 27 2.6 SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pomb... 27 3.4 >SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 27.1 bits (57), Expect = 2.6 Identities = 16/55 (29%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = -1 Query: 196 VFISANGITNPHYTKSSSFRINNSNLTSLKTHFGSAKVINRT-LPISAANHPCIT 35 V ++ IT+P+ T SSS +++ ++ T + T ++KV + T +P+++ N T Sbjct: 597 VLYTSTPITSPNSTSSSSTQVSWNSTTPI-TGTSTSKVTSSTSIPLTSTNRTSTT 650 >SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1334 Score = 26.6 bits (56), Expect = 3.4 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 172 TNPHYTKSSSFRINNSNLTSLKTHFGSAKVINR 74 T PH+ + S+ NNSN SL H S N+ Sbjct: 130 TTPHFPQVSNHAPNNSNSPSLTWHTSSGDDSNQ 162 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,966,175 Number of Sequences: 5004 Number of extensions: 60913 Number of successful extensions: 311 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 305 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -