Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0447
         (691 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_15902| Best HMM Match : AMOP (HMM E-Value=3.5e-13)                  28   8.2  

>SB_15902| Best HMM Match : AMOP (HMM E-Value=3.5e-13)
          Length = 609

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%)
 Frame = -1

Query: 169 NPHYTKSSSFRINNSNLTSLKTHFGSAKVINRT-LPISAANHPCITDS 29
           N  YTK  S  + + N+TS  T   S   +N T   I++ N   I DS
Sbjct: 310 NITYTKMMSTNVTSQNMTSSNTTSPSMTSVNTTATSITSTNSTLIADS 357


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,677,767
Number of Sequences: 59808
Number of extensions: 433275
Number of successful extensions: 1127
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1073
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1127
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1793485733
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)