BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0446 (704 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q98RX5 Cluster: Chromosomal region maintenance protein ... 38 0.32 UniRef50_Q54R50 Cluster: Putative uncharacterized protein; n=2; ... 37 0.42 >UniRef50_Q98RX5 Cluster: Chromosomal region maintenance protein CRM1; n=1; Guillardia theta|Rep: Chromosomal region maintenance protein CRM1 - Guillardia theta (Cryptomonas phi) Length = 949 Score = 37.5 bits (83), Expect = 0.32 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 5/121 (4%) Frame = -1 Query: 377 IRIRTSNS-KIYNNVLSMFCL*LRSQGL*SLNDIIIFCLILLVRNFLANDINFRIPLFYN 201 I+I SN Y N L LND+ IF ++ + + + +F+I L +N Sbjct: 712 IKILNSNKINFYKNFFERVSFILLKNFFQILNDLSIFLYLIFILRKIISSKSFKIKLIFN 771 Query: 200 IK*AIFC*IQEMGSFQF---L*CVFY-NALSAKVLLLKHREVLNFFFVSNFEDLFLILMT 33 +I ++ SF L F+ N L ++LK +L+ F S F+D FLIL+T Sbjct: 772 ---SIILGFKKFKSFSLDSKLRVFFFKNFLIVSSIILKKCSILSIFKKSLFKD-FLILLT 827 Query: 32 Q 30 + Sbjct: 828 E 828 >UniRef50_Q54R50 Cluster: Putative uncharacterized protein; n=2; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 455 Score = 37.1 bits (82), Expect = 0.42 Identities = 22/47 (46%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = +1 Query: 163 PISCIQQNIAHLI-L*NKGIRKFISLAKKLRTNNIKQNIIMSFKDYR 300 P+ I++ I HLI NK I KF L+K ++T IKQ I+SFKD + Sbjct: 5 PLIVIKKIILHLIRYKNKNILKFFFLSKSIQTFIIKQIEILSFKDIK 51 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 631,849,319 Number of Sequences: 1657284 Number of extensions: 11664398 Number of successful extensions: 25754 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25750 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 56198352344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -