BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0446 (704 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28971-4|AAK68668.1| 628|Caenorhabditis elegans Hypothetical pr... 30 1.4 AC006698-1|AAF39993.3| 398|Caenorhabditis elegans Hypothetical ... 28 7.5 >U28971-4|AAK68668.1| 628|Caenorhabditis elegans Hypothetical protein B0244.10 protein. Length = 628 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 259 Y*FVISWLTI*ISVSLCFIISNEQYFVEYKRWAHFSFYNVFF 134 Y FV+ L+ I ++LC II YF++ F+F+ V F Sbjct: 360 YIFVVVRLSAAILIALCIIIIQSTYFIDIPFRDTFAFFAVLF 401 >AC006698-1|AAF39993.3| 398|Caenorhabditis elegans Hypothetical protein W10C4.1 protein. Length = 398 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 600 VTTFSMFSINYTFRVSHLGNVMHIATAAS 514 + F F+ NYTFR +L + MH+ A+ Sbjct: 79 LANFDRFAFNYTFRYLYLPSKMHLIAFAN 107 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,234,612 Number of Sequences: 27780 Number of extensions: 306604 Number of successful extensions: 744 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -