BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0440 (646 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4YRF0 Cluster: Putative uncharacterized protein; n=1; ... 39 0.090 >UniRef50_Q4YRF0 Cluster: Putative uncharacterized protein; n=1; Plasmodium berghei|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 205 Score = 39.1 bits (87), Expect = 0.090 Identities = 26/89 (29%), Positives = 46/89 (51%), Gaps = 8/89 (8%) Frame = -1 Query: 493 IVNTKQMILLYVPVFF----CENSHHNCLSRFYFAVVER--QNVSVVTYRTYLRMKQYVL 332 I+N KQ+ + +P+F C N H+ +Y+ E+ +N+S+ Y++ ++L Sbjct: 39 IINNKQIENIILPIFIKKGECINYDHSEFFFYYYKNSEQIFKNISIDCTNKYMQPSFHML 98 Query: 331 YNY--IIRYHNIFDNNGTPLLIWIQQIFN 251 I YHN F+NN LL + +Q F+ Sbjct: 99 REKRDFINYHNFFNNNKNYLLPYWEQNFH 127 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,165,685 Number of Sequences: 1657284 Number of extensions: 10764112 Number of successful extensions: 22128 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 21090 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22124 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48541014171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -