BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0438 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_03_0167 + 15041626-15043029 34 0.094 03_03_0166 - 15027065-15028465 34 0.12 02_02_0663 - 12740733-12741104,12741260-12741326,12741709-127418... 29 2.7 04_03_0075 + 10726807-10727721,10728756-10729496 28 6.2 >03_03_0167 + 15041626-15043029 Length = 467 Score = 34.3 bits (75), Expect = 0.094 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = +3 Query: 222 THLVSECLLRCISSTIAIGCFSARRG*RLKREVASLVRNCTSAD---YSC 362 T ++ +CL RC + + + A RG R K E+ LVR+ T+A YSC Sbjct: 216 TMMLGQCLFRCGGAAVLLSSDPAHRG-RAKMELRRLVRSTTAASDDAYSC 264 >03_03_0166 - 15027065-15028465 Length = 466 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = +3 Query: 222 THLVSECLLRCISSTIAIGCFSARRG*RLKREVASLVRNCTSAD---YSC 362 T ++++CL RC + + + A RG R K E+ LVR+ T+A YSC Sbjct: 215 TMMLAQCLFRCGGAAVLLSNDPAHRG-RAKMELRRLVRSTTAASDDAYSC 263 >02_02_0663 - 12740733-12741104,12741260-12741326,12741709-12741809, 12741852-12742273,12743678-12743685,12745164-12745396 Length = 400 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +2 Query: 206 EKQYLHSLSIGMPAEVHFKYHSNRLFLGTKRLTAKARSCQPCTKLY 343 +K+YL + A + F H+N L L K++ +A +C PC + + Sbjct: 247 QKRYLSLIYYDNHANMLFALHTNNLLLEIKKVYTEAYTC-PCVRYH 291 >04_03_0075 + 10726807-10727721,10728756-10729496 Length = 551 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 227 VSVNIVSQSFSYRQIERILYSPTVKF 150 V VN+VS+SF+Y + +PT KF Sbjct: 147 VGVNLVSESFAYAYLSNRAITPTNKF 172 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,416,803 Number of Sequences: 37544 Number of extensions: 302974 Number of successful extensions: 516 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 516 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -