BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0438 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_939| Best HMM Match : PH (HMM E-Value=6.9e-14) 34 0.13 SB_32302| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 >SB_939| Best HMM Match : PH (HMM E-Value=6.9e-14) Length = 1030 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = -2 Query: 342 YSFVQGWQLLALAVSLFVPRNNRLLW 265 Y ++Q WQLLA+ SLFVP+ + L++ Sbjct: 940 YVYLQTWQLLAMCTSLFVPKQHFLVY 965 >SB_32302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 32.3 bits (70), Expect = 0.39 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = +2 Query: 176 CVRFDGRKTIEKQYLHSLSIGMPAEVHFKYHSNRLFLGTKRLTAKARSCQPCTKLYVGG 352 C G TI+++ L+SL+ G+ FK +R F ++T K + PC +Y+ G Sbjct: 91 CHTSKGNLTIQRKPLYSLN-GIKMSKVFKAVVSRPFPSADKMTPKHKHTMPCHSMYIFG 148 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,909,146 Number of Sequences: 59808 Number of extensions: 379896 Number of successful extensions: 783 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 783 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -