BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0438 (700 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-113|AAF45555.2| 1561|Drosophila melanogaster CG12467-PA... 82 8e-16 AL031583-9|CAA20901.1| 1014|Drosophila melanogaster EG:34F3.2 pr... 81 1e-15 >AE014298-113|AAF45555.2| 1561|Drosophila melanogaster CG12467-PA protein. Length = 1561 Score = 81.8 bits (193), Expect = 8e-16 Identities = 37/48 (77%), Positives = 42/48 (87%), Gaps = 2/48 (4%) Frame = -2 Query: 393 NFQAPLLS--VDCKSNPPTYSFVQGWQLLALAVSLFVPRNNRLLWYLK 256 + QAP + +DCKSNPP YSFVQGWQLLALAVSLFVPR++RLLWYLK Sbjct: 1026 SIQAPSATPIIDCKSNPPVYSFVQGWQLLALAVSLFVPRSSRLLWYLK 1073 >AL031583-9|CAA20901.1| 1014|Drosophila melanogaster EG:34F3.2 protein. Length = 1014 Score = 81.0 bits (191), Expect = 1e-15 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -2 Query: 369 VDCKSNPPTYSFVQGWQLLALAVSLFVPRNNRLLWYLK 256 +DCKSNPP YSFVQGWQLLALAVSLFVPR++RLLWYLK Sbjct: 489 IDCKSNPPVYSFVQGWQLLALAVSLFVPRSSRLLWYLK 526 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,486,778 Number of Sequences: 53049 Number of extensions: 550024 Number of successful extensions: 913 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 891 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 913 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3067209849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -