BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0433 (624 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ512501-1|CAD54734.1| 4007|Homo sapiens extracellular matrix pr... 30 7.6 AB040933-1|BAA96024.2| 2240|Homo sapiens KIAA1500 protein protein. 30 7.6 >AJ512501-1|CAD54734.1| 4007|Homo sapiens extracellular matrix protein protein. Length = 4007 Score = 29.9 bits (64), Expect = 7.6 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 Query: 502 GCMQNAKRIKHGFLSYDYRTIRIRFSKFHDYKFK 401 GC+Q K +KH FL D + FHD F+ Sbjct: 3746 GCIQPNKHLKHRFLLLDRNQPEVTDKYFHDVPFE 3779 >AB040933-1|BAA96024.2| 2240|Homo sapiens KIAA1500 protein protein. Length = 2240 Score = 29.9 bits (64), Expect = 7.6 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 Query: 502 GCMQNAKRIKHGFLSYDYRTIRIRFSKFHDYKFK 401 GC+Q K +KH FL D + FHD F+ Sbjct: 1979 GCIQPNKHLKHRFLLLDRNQPEVTDKYFHDVPFE 2012 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,734,198 Number of Sequences: 237096 Number of extensions: 1787322 Number of successful extensions: 3125 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3122 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6747805200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -