BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0430 (590 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identica... 53 2e-07 >At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identical to cytochrome c oxidase subunit 3 (GI:15215914) [Arabidopsis thaliana]; similar to Cytochrome c oxidase polypeptide III (EC 1.9.3.1) (Swiss-Prot:P92514) [Arabidopsis thaliana] Length = 265 Score = 52.8 bits (121), Expect = 2e-07 Identities = 27/69 (39%), Positives = 37/69 (53%) Frame = +2 Query: 287 LSPNIEIGRI*PPSRITPFNPFQIPLLNTIILIRSGVTVT*AHHSLIENNFSQTKQRXFL 466 L+P +EIG I PP I +P++IP LNT IL SG VT AHH+++ + Sbjct: 109 LAPAVEIGGIWPPKGIEVLDPWEIPFLNTPILPSSGAAVTWAHHAILAGKEKRAVYALVA 168 Query: 467 TIXLGFYXT 493 T+ L T Sbjct: 169 TVLLALVFT 177 Score = 43.2 bits (97), Expect = 1e-04 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = +1 Query: 496 FTXI*YIGASFTIAXRIYGSTFFIATGFHG 585 F + Y A FTI+ IYGSTFF+ATGFHG Sbjct: 179 FQGMEYYQAPFTISDSIYGSTFFLATGFHG 208 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,093,469 Number of Sequences: 28952 Number of extensions: 105857 Number of successful extensions: 130 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -