BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0429 (702 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-1363|AAF52578.3| 346|Drosophila melanogaster CG33121-P... 29 4.6 AE014297-4123|AAF56704.1| 245|Drosophila melanogaster CG13980-P... 29 6.1 >AE014134-1363|AAF52578.3| 346|Drosophila melanogaster CG33121-PA protein. Length = 346 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +3 Query: 309 LIIHNKYIKSIEKTLRTL-PCI*QTHAYICTLLFIVKVVTNKIEN 440 L +HN Y+ SIEK LRTL + + + ++ F +K T +E+ Sbjct: 205 LPLHNTYLSSIEKILRTLSESLVENNVHVELPKFKIKYQTELVES 249 >AE014297-4123|AAF56704.1| 245|Drosophila melanogaster CG13980-PA protein. Length = 245 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 291 EKERRMLIIHNKYIKSIEKTLRTLPCI*QTHAY 389 E ERR+ +N Y K+++ T +T C+ HAY Sbjct: 91 EAERRLSPDYNAYEKALQCTTKTHRCLHAAHAY 123 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,501,681 Number of Sequences: 53049 Number of extensions: 482141 Number of successful extensions: 722 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3087795150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -