Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0427
         (696 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U28809-1|AAC47326.1|  140|Anopheles gambiae lysozyme protein.          27   0.43 
DQ007317-1|AAY24699.1|  140|Anopheles gambiae lysozyme c-1 protein.    27   0.43 
AJ973475-1|CAJ01522.1|  127|Anopheles gambiae hypothetical prote...    25   2.3  
AJ697728-1|CAG26921.1|  127|Anopheles gambiae putative sensory a...    25   2.3  
DQ004400-1|AAY21239.1|  144|Anopheles gambiae lysozyme c-5 protein.    24   4.0  

>U28809-1|AAC47326.1|  140|Anopheles gambiae lysozyme protein.
          Length = 140

 Score = 27.5 bits (58), Expect = 0.43
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = -2

Query: 659 YRTWRGWKNHCS 624
           +  W GWKNHC+
Sbjct: 118 FNAWYGWKNHCN 129


>DQ007317-1|AAY24699.1|  140|Anopheles gambiae lysozyme c-1 protein.
          Length = 140

 Score = 27.5 bits (58), Expect = 0.43
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = -2

Query: 659 YRTWRGWKNHCS 624
           +  W GWKNHC+
Sbjct: 118 FNAWYGWKNHCN 129


>AJ973475-1|CAJ01522.1|  127|Anopheles gambiae hypothetical protein
           protein.
          Length = 127

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 14/43 (32%), Positives = 21/43 (48%)
 Frame = +2

Query: 29  MKLLVVFAMCMLAASAGVVELSADTSNQDLEEKLYNSILTGDY 157
           MKL V  A  +LA +A   + +      DL+E L +  L  +Y
Sbjct: 1   MKLFVAIAFALLALAAAQEQYTTKYDGIDLDEILKSDRLFNNY 43


>AJ697728-1|CAG26921.1|  127|Anopheles gambiae putative sensory
           appendage protein SAP-2 protein.
          Length = 127

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 14/43 (32%), Positives = 21/43 (48%)
 Frame = +2

Query: 29  MKLLVVFAMCMLAASAGVVELSADTSNQDLEEKLYNSILTGDY 157
           MKL V  A  +LA +A   + +      DL+E L +  L  +Y
Sbjct: 1   MKLFVAIAFALLALAAAQEQYTTKYDGIDLDEILKSDRLFNNY 43


>DQ004400-1|AAY21239.1|  144|Anopheles gambiae lysozyme c-5 protein.
          Length = 144

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = -2

Query: 659 YRTWRGWKNHC 627
           + +W GW+N+C
Sbjct: 118 FNSWEGWRNNC 128


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 697,869
Number of Sequences: 2352
Number of extensions: 12676
Number of successful extensions: 29
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 70668195
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)