BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0425 (517 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18511| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_56071| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_18511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 130 LFLGVFITIFYCHYDMRGIF*QLFLFRGTAKPLPT 234 L L VFI F +RG+F Q + F+G P+ T Sbjct: 127 LGLYVFILYFILRNQVRGVFKQTYAFQGEPPPIQT 161 >SB_56071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 856 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/39 (28%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = -3 Query: 137 KNSHIYTEI-TNAGWFSLHLESSDRVRVSHKSN*VRYRF 24 K+S I++++ N+G++ +HL+ ++R + + R+RF Sbjct: 528 KDSSIFSKLDANSGFWQIHLDDESKLRTTFVTPFRRFRF 566 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,296,965 Number of Sequences: 59808 Number of extensions: 229518 Number of successful extensions: 641 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 640 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -