BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0421 (473 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 3.3 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 7.7 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.8 bits (44), Expect = 3.3 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 465 HEQVVNGAWSRARVL 421 H +G+W RARVL Sbjct: 150 HPMNFSGSWKRARVL 164 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 20.6 bits (41), Expect = 7.7 Identities = 11/43 (25%), Positives = 17/43 (39%) Frame = +1 Query: 253 HRDEWLTMEQTCYNMMRKQXQEEVAASIQYLAMGAYFSIDTVN 381 H D E CY +K+ ++E I+ S+D N Sbjct: 217 HPDSGNMFENGCYLRRQKRFKDEKKELIRQTHKSPSHSVDNSN 259 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,659 Number of Sequences: 336 Number of extensions: 1578 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11036865 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -