BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0415 (636 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1781 + 39832977-39833284,39835083-39835261,39836085-398361... 33 0.14 01_03_0028 - 11783122-11783381,11783668-11784163 27 9.4 >01_06_1781 + 39832977-39833284,39835083-39835261,39836085-39836170, 39836205-39836293,39837477-39837579,39837940-39837968, 39838668-39838830,39838901-39838954,39839443-39839621, 39839869-39840001 Length = 440 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = -2 Query: 377 ATEVNVATENIINICFFANVIFFKRSQ*I*KYKREVKKAQTLPICYYNSCLGC 219 A++V++ +N+ +V + + + KY R + T PIC YN C GC Sbjct: 317 ASQVDMIKPMYLNVSISYDVKVLNKER-LPKYARRMLIGSTAPICTYNECRGC 368 >01_03_0028 - 11783122-11783381,11783668-11784163 Length = 251 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 251 PICYYNSCLGCPRP*IDHRNSLTLCS 174 P+C++ L PRP H + +TLCS Sbjct: 132 PVCFFAEALRPPRPGY-HEDDITLCS 156 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,030,344 Number of Sequences: 37544 Number of extensions: 209536 Number of successful extensions: 362 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 362 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -