BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0414 (570 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0416 + 23307984-23308281,23310083-23310900 27 8.0 11_06_0344 + 22540436-22540737,22541304-22543545 27 8.0 >11_06_0416 + 23307984-23308281,23310083-23310900 Length = 371 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 164 LALLTSMVDGNHSPPGRPYARLPTRAIKKLIT 69 ++LL + DG+H PP R TR+ + IT Sbjct: 108 ISLLAAAHDGSHPPPPRSDQSTATRSFPRFIT 139 >11_06_0344 + 22540436-22540737,22541304-22543545 Length = 847 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 88 ALVGRRAYGRPGGEWLPSTMDVSNARGRAKPLSTVDSL 201 ALVG R RP WLPS V+ + G +P T + L Sbjct: 30 ALVGSRDLERPRSPWLPSE-PVNCSGGLGRPWMTPEPL 66 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,150,115 Number of Sequences: 37544 Number of extensions: 235581 Number of successful extensions: 481 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1317005676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -