BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0411 (705 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 26 1.3 AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription fact... 26 1.3 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 24 5.4 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 23 7.1 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 7.1 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 349 NYCYNYKIVNTSLHLLIVFFREE 417 NY YNY N S H L F+R + Sbjct: 162 NYYYNYYCRNISHHFLRCFYRHK 184 >AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription factor protein. Length = 391 Score = 25.8 bits (54), Expect = 1.3 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 169 DFK*RPQGSSSDSSVHIVTTPYRRPAPYSATPATYK 276 D + P S V VT YR PAP PA K Sbjct: 70 DAEEEPAKGSKRRKVGTVTKAYREPAPKKQAPAKAK 105 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 23.8 bits (49), Expect = 5.4 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +1 Query: 586 LICSKSQLLTHYVM*YVMLLC*YLHYC-LGVCTYYFGG 696 ++CS S +TH M LL + YC L TY GG Sbjct: 138 ILCSLSVAITHVTMVDFKLLQ-VIPYCVLDTITYMMGG 174 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 23.4 bits (48), Expect = 7.1 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +2 Query: 590 FVQNRNC*RTTLCSMLCCFVNIYTI 664 ++Q C T S LCCF++++ + Sbjct: 186 YIQEICCRFFTFSSSLCCFLSVWFV 210 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.4 bits (48), Expect = 7.1 Identities = 12/59 (20%), Positives = 24/59 (40%) Frame = -3 Query: 478 KVYHSNSNQPNISTYMKTIIILLERKQLTNGVMY*QFYNYNNNSMNSHQLLELSQ*IHV 302 K Y +S P + ++ + Q + F+N N +M + +L++ HV Sbjct: 259 KAYTIDSTNPMVLNHLANHFFFKKDYQKVQHLALHAFHNTENEAMRAESCYQLARAFHV 317 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 740,361 Number of Sequences: 2352 Number of extensions: 15341 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -