BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0411 (705 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BX537405-1|CAD97647.1| 1109|Homo sapiens hypothetical protein pr... 33 0.99 BC098406-1|AAH98406.1| 1105|Homo sapiens RAN binding protein 6 p... 33 0.99 BC012805-1|AAH12805.2| 414|Homo sapiens RANBP6 protein protein. 33 0.99 AL162384-1|CAI12713.1| 1105|Homo sapiens RAN binding protein 6 p... 33 0.99 AF039023-1|AAC14260.1| 1105|Homo sapiens Ran-GTP binding protein... 33 0.99 >BX537405-1|CAD97647.1| 1109|Homo sapiens hypothetical protein protein. Length = 1109 Score = 33.1 bits (72), Expect = 0.99 Identities = 13/59 (22%), Positives = 36/59 (61%) Frame = +2 Query: 38 RVLATLAEAFRADAVPNDNPVYAQMVALLRQIQSNAELFNSCLMTLSNDHKXALQIALS 214 ++++ +AE + + ++P ++ ++RQ+Q++ +L+ C+ L ++ + ALQ L+ Sbjct: 1049 KIISIIAEGKINETINYEDPCAKRLANVVRQVQTSEDLWLECVSQLDDEQQEALQELLN 1107 >BC098406-1|AAH98406.1| 1105|Homo sapiens RAN binding protein 6 protein. Length = 1105 Score = 33.1 bits (72), Expect = 0.99 Identities = 13/59 (22%), Positives = 36/59 (61%) Frame = +2 Query: 38 RVLATLAEAFRADAVPNDNPVYAQMVALLRQIQSNAELFNSCLMTLSNDHKXALQIALS 214 ++++ +AE + + ++P ++ ++RQ+Q++ +L+ C+ L ++ + ALQ L+ Sbjct: 1045 KIISIIAEGKINETINYEDPCAKRLANVVRQVQTSEDLWLECVSQLDDEQQEALQELLN 1103 >BC012805-1|AAH12805.2| 414|Homo sapiens RANBP6 protein protein. Length = 414 Score = 33.1 bits (72), Expect = 0.99 Identities = 13/59 (22%), Positives = 36/59 (61%) Frame = +2 Query: 38 RVLATLAEAFRADAVPNDNPVYAQMVALLRQIQSNAELFNSCLMTLSNDHKXALQIALS 214 ++++ +AE + + ++P ++ ++RQ+Q++ +L+ C+ L ++ + ALQ L+ Sbjct: 354 KIISIIAEGKINETINYEDPCAKRLANVVRQVQTSEDLWLECVSQLDDEQQEALQELLN 412 >AL162384-1|CAI12713.1| 1105|Homo sapiens RAN binding protein 6 protein. Length = 1105 Score = 33.1 bits (72), Expect = 0.99 Identities = 13/59 (22%), Positives = 36/59 (61%) Frame = +2 Query: 38 RVLATLAEAFRADAVPNDNPVYAQMVALLRQIQSNAELFNSCLMTLSNDHKXALQIALS 214 ++++ +AE + + ++P ++ ++RQ+Q++ +L+ C+ L ++ + ALQ L+ Sbjct: 1045 KIISIIAEGKINETINYEDPCAKRLANVVRQVQTSEDLWLECVSQLDDEQQEALQELLN 1103 >AF039023-1|AAC14260.1| 1105|Homo sapiens Ran-GTP binding protein protein. Length = 1105 Score = 33.1 bits (72), Expect = 0.99 Identities = 13/59 (22%), Positives = 36/59 (61%) Frame = +2 Query: 38 RVLATLAEAFRADAVPNDNPVYAQMVALLRQIQSNAELFNSCLMTLSNDHKXALQIALS 214 ++++ +AE + + ++P ++ ++RQ+Q++ +L+ C+ L ++ + ALQ L+ Sbjct: 1045 KIISIIAEGKINETINYEDPCAKRLANVVRQVQTSEDLWLECVSQLDDEQQEALQELLN 1103 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,895,778 Number of Sequences: 237096 Number of extensions: 1856221 Number of successful extensions: 7759 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7759 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8175213644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -