BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0410 (654 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17A2.09c |csx1||RNA-binding protein Csx1|Schizosaccharomyces... 28 1.0 SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pomb... 28 1.4 SPAC823.07 |||GPI-phospholipase A2 activity regulator |Schizosac... 26 4.1 SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2... 26 5.5 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 9.5 SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr... 25 9.5 SPBC1773.07c |sbp1|yrb1|Ran GTPase binding protein Sbp1|Schizosa... 25 9.5 >SPAC17A2.09c |csx1||RNA-binding protein Csx1|Schizosaccharomyces pombe|chr 1|||Manual Length = 632 Score = 28.3 bits (60), Expect = 1.0 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +3 Query: 282 GVQPMSREPPD*D*TYTLNGEVYVWMRILGLSEIGGNTGSGETVELSEWL 431 G+ P+S P T + G+VY +L S+I G+ +V+L EWL Sbjct: 475 GLTPLSSHFPSAA-TGLVGGQVYPQSSVLQSSKINGSAKVQPSVKLPEWL 523 >SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1095 Score = 27.9 bits (59), Expect = 1.4 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 299 RHWLHSLMDDIVTLLGTDT*NYVMSFYYYLCK 204 + W +MDD++ G D+ NY F YL + Sbjct: 885 KQWALCMMDDLIEFTGPDSWNYKDHFLPYLAE 916 >SPAC823.07 |||GPI-phospholipase A2 activity regulator |Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 26.2 bits (55), Expect = 4.1 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +1 Query: 262 VTMSSIKEC--NQCRGSPPTRTKLIPLMVK-FMYGCG 363 V +S + C N+C G+P +KL PL +K F + CG Sbjct: 32 VYVSCVNRCIENKCHGNPSDTSKL-PLDLKLFRWDCG 67 >SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 474 Score = 25.8 bits (54), Expect = 5.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 353 YINFTIKGISLVLVGGLPRHWLHSLMDDIVTLLGT 249 Y N T++G S L G+ +H M D+V ++ T Sbjct: 214 YFNITVEGPSADLHSGVFGGTVHEPMTDLVAIMST 248 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.0 bits (52), Expect = 9.5 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -1 Query: 633 DSLIPYKDNFEPLNSKLNKIIDKPQVLISDDNHYNS 526 +S I Y D EPL+ LNK ++K +++ D + S Sbjct: 174 ESKIGYAD--EPLSELLNKCMEKLEIVEQDPQFWQS 207 >SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 780 Score = 25.0 bits (52), Expect = 9.5 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -1 Query: 591 SKLNKIIDKPQVLISDDNHYNSLSL 517 S+LN I+ VL +DNH++SLS+ Sbjct: 342 SQLNPILRSENVL-QNDNHHSSLSM 365 >SPBC1773.07c |sbp1|yrb1|Ran GTPase binding protein Sbp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 215 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +3 Query: 126 LNSGDPRLNKY-IKIKNSENTLMFKVNF 206 ++ G+P + I+ NSEN +FK NF Sbjct: 174 VSEGEPTAETFAIRFANSENANLFKENF 201 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,342,234 Number of Sequences: 5004 Number of extensions: 43709 Number of successful extensions: 97 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -