BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0409 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26814| Best HMM Match : 7tm_1 (HMM E-Value=0) 28 6.3 SB_11923| Best HMM Match : Toxin_3 (HMM E-Value=0.32) 28 8.4 >SB_26814| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 594 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +3 Query: 486 FSAGKLCILLHHWP---VEVVIVK*VHSQILIIFYIAGESSMILLRASLHTDVG 638 +++G CI+L HWP + + I+ + I+++F AG ++ +A L VG Sbjct: 170 YASGTGCIVLLHWPWRFLLIFIIGFLVPLIIMVFCYAGILVVVSSKARLSNRVG 223 >SB_11923| Best HMM Match : Toxin_3 (HMM E-Value=0.32) Length = 884 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +3 Query: 582 IAGESSMILLRASLHT--DVGDLKIMCSGLYISMDCIWK 692 I E+ +I L + + D+ D KI+C G Y + D WK Sbjct: 470 INAETEVIFLDEASESILDIDDWKILCQGGYTAHDAKWK 508 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,970,464 Number of Sequences: 59808 Number of extensions: 337759 Number of successful extensions: 647 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -