BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0409 (700 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003142-1|AAB54189.2| 389|Caenorhabditis elegans Hypothetical ... 29 4.2 Z78013-8|CAN99686.1| 373|Caenorhabditis elegans Hypothetical pr... 28 7.4 Z77652-10|CAI70404.1| 307|Caenorhabditis elegans Hypothetical p... 27 9.8 >AF003142-1|AAB54189.2| 389|Caenorhabditis elegans Hypothetical protein F57C9.6 protein. Length = 389 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +1 Query: 304 ICRQERSLSHYILINASILRCLCVCCMKLVXSLHKINLYII 426 I QE SLSHY + + IL C+ C+ + S + I II Sbjct: 212 IKHQETSLSHYFVFH-MILIAFCLICLAITASCYFILFRII 251 >Z78013-8|CAN99686.1| 373|Caenorhabditis elegans Hypothetical protein F15B9.10 protein. Length = 373 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 Query: 242 WLFNFIYNFXLPCFCFCCSI*FVAKRG 322 WL+ F+ LP C CC I RG Sbjct: 222 WLWIFVIGIVLPTLCCCCCIYCCCCRG 248 >Z77652-10|CAI70404.1| 307|Caenorhabditis elegans Hypothetical protein C06B3.12 protein. Length = 307 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/45 (26%), Positives = 26/45 (57%) Frame = +3 Query: 36 MILMLSTTLFVFFFFRENLLYT*LVQKKRKSSLKATLYIYSILYC 170 ++L+ STT +FF++ ++ +K+ T+YIY+++ C Sbjct: 15 LVLIFSTTFLIFFYWT--------IRTYKKNDKLPTIYIYTMILC 51 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,738,496 Number of Sequences: 27780 Number of extensions: 279005 Number of successful extensions: 534 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -