BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0408 (655 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69790-1|CAA93654.2| 427|Caenorhabditis elegans Hypothetical pr... 30 1.6 Z49071-1|CAA88873.2| 269|Caenorhabditis elegans Hypothetical pr... 29 3.8 >Z69790-1|CAA93654.2| 427|Caenorhabditis elegans Hypothetical protein F33C8.2 protein. Length = 427 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -2 Query: 339 DRTNARKIRQSCSILIEFQNREPA 268 DR N K+ + SIL EFQN++PA Sbjct: 2 DRENTEKLCRRFSILNEFQNKQPA 25 >Z49071-1|CAA88873.2| 269|Caenorhabditis elegans Hypothetical protein T22C8.1 protein. Length = 269 Score = 28.7 bits (61), Expect = 3.8 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 1/69 (1%) Frame = -3 Query: 542 WLFIDRLL*FCPH*SGT*TKKVMNKNISLFVDLRQFNLLYNF*-ISILTTNIRMMGMYIS 366 W++I+ ++ F + GT TK K IS+ L N+L F +S I M+GMY+ Sbjct: 66 WVYINFIV-FWNYNFGT-TKTFSRKTISMKEVLLGTNILTKFFTLSSTCLPIAMLGMYLV 123 Query: 365 LFSF*VQMK 339 +F F V+ + Sbjct: 124 IFIFIVKKR 132 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,762,348 Number of Sequences: 27780 Number of extensions: 273540 Number of successful extensions: 487 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 487 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -