BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0405 (660 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81038-5|CAB02766.3| 970|Caenorhabditis elegans Hypothetical pr... 29 2.2 AB096631-1|BAC76731.1| 972|Caenorhabditis elegans isoleucyl-tRN... 29 2.2 >Z81038-5|CAB02766.3| 970|Caenorhabditis elegans Hypothetical protein C25A1.7 protein. Length = 970 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -3 Query: 592 FSRINFARA--VWXHKKPXR*SEYFALSSTTS 503 F INF+ + +W H +P + S++FAL TT+ Sbjct: 252 FKLINFSSSDVIWAHSEPSKISQFFALIWTTT 283 >AB096631-1|BAC76731.1| 972|Caenorhabditis elegans isoleucyl-tRNA synthetase (mitochondrial)protein. Length = 972 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -3 Query: 592 FSRINFARA--VWXHKKPXR*SEYFALSSTTS 503 F INF+ + +W H +P + S++FAL TT+ Sbjct: 252 FKLINFSSSDVIWAHSEPSKISQFFALIWTTT 283 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,742,896 Number of Sequences: 27780 Number of extensions: 184221 Number of successful extensions: 167 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 167 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1476380920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -