BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0400 (638 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 1.9 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 3.3 DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 22 4.4 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 22 4.4 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 7.6 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.4 bits (48), Expect = 1.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 266 IQNYKKQKQTNILTTFLSKTFRVLKAPVN 352 I + K QK N F FR+L APVN Sbjct: 375 IVSNKYQKIANGDLNFNEVNFRILNAPVN 403 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 487 EGGSLPLLYLSVNFTSDCCFIFT 419 E LP L L N+T+DC +++ Sbjct: 205 ENIELPQLQLVKNYTADCTQVYS 227 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 22.2 bits (45), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +3 Query: 348 SMYPEENNSADRSPPEASVFQM*NVNIKQQSLVKFTDRYKSGNE 479 S+Y +EN + E SV N+ I+ LVK +YK+ E Sbjct: 89 SIYLDEN-VIKKLVAECSVISDANIYIRFNKLVKCFGKYKTMKE 131 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 22.2 bits (45), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +3 Query: 348 SMYPEENNSADRSPPEASVFQM*NVNIKQQSLVKFTDRYKSGNE 479 S+Y +EN + E SV N+ I+ LVK +YK+ E Sbjct: 89 SIYLDEN-VIKKLVAECSVISDANIYIRFNKLVKCFGKYKTMKE 131 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 475 LPLLYLSVNFTSDC 434 LP L +S N+T+DC Sbjct: 178 LPQLDISNNYTTDC 191 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,321 Number of Sequences: 438 Number of extensions: 3091 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -