BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0397 (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 25 0.47 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 25 0.47 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 25 0.47 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 7.7 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 7.7 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 25.4 bits (53), Expect = 0.47 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 276 IPVFLGFVQSSIWKLLAWVWQFWLL 202 +P L F+Q + AW+W WLL Sbjct: 202 VPPPLMFLQDFLSHQHAWIWLVWLL 226 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 25.4 bits (53), Expect = 0.47 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 276 IPVFLGFVQSSIWKLLAWVWQFWLL 202 +P L F+Q + AW+W WLL Sbjct: 435 VPPPLMFLQDFLSHQHAWIWLVWLL 459 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 25.4 bits (53), Expect = 0.47 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 276 IPVFLGFVQSSIWKLLAWVWQFWLL 202 +P L F+Q + AW+W WLL Sbjct: 435 VPPPLMFLQDFLSHQHAWIWLVWLL 459 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.9 Identities = 17/52 (32%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = -3 Query: 336 TFL*ALSALVTGFTTFFCPLIPVFLGFVQSSIWKLL-------AWVWQFWLL 202 + L A L G FF IP +L F + L AW+W WLL Sbjct: 421 SLLIAACGLRNGDPCFFHDTIPPYLFFESPPVVFLNDFISHQHAWIWLLWLL 472 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.9 Identities = 17/52 (32%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = -3 Query: 336 TFL*ALSALVTGFTTFFCPLIPVFLGFVQSSIWKLL-------AWVWQFWLL 202 + L A L G FF IP +L F + L AW+W WLL Sbjct: 421 SLLIAACGLRNGDPCFFHDTIPPYLFFESPPVVFLNDFISHQHAWIWLLWLL 472 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.9 Identities = 17/52 (32%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = -3 Query: 336 TFL*ALSALVTGFTTFFCPLIPVFLGFVQSSIWKLL-------AWVWQFWLL 202 + L A L G FF IP +L F + L AW+W WLL Sbjct: 421 SLLIAACGLRNGDPCFFHDTIPPYLFFESPPVVFLNDFISHQHAWIWLLWLL 472 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.9 Identities = 17/52 (32%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = -3 Query: 336 TFL*ALSALVTGFTTFFCPLIPVFLGFVQSSIWKLL-------AWVWQFWLL 202 + L A L G FF IP +L F + L AW+W WLL Sbjct: 421 SLLIAACGLRNGDPCFFHDTIPPYLFFESPPVVFLNDFISHQHAWIWLLWLL 472 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.4 bits (43), Expect = 7.7 Identities = 15/55 (27%), Positives = 20/55 (36%) Frame = -2 Query: 526 LQSSSLCFRREREFNDVVGIHAISLRQRLPWVFRVPRRFKRLGSAEMHRVANFPY 362 L+S SL R N H + +L W V + L E+ FPY Sbjct: 165 LKSDSLAVRLSAA-NFFGARHGLETLNQLIWFDEVVNELRILHGVEIRDYPKFPY 218 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +2 Query: 191 GCGNSSQNCQTQASSFQIEDC 253 G G + C T A F DC Sbjct: 498 GNGRCDEECNTYACEFDGNDC 518 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,342 Number of Sequences: 336 Number of extensions: 2733 Number of successful extensions: 17 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -