BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0397 (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 1.8 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 23 9.7 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.4 bits (53), Expect = 1.8 Identities = 13/58 (22%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +2 Query: 554 TQVQTSTISRLQSRNSMI*MLLKSTHSSGL-MVRRKRTFDSLEIMTLGRCQQNWASYK 724 T ++ T+S +++ + + THS+ V +R D+ ++ T+G +++++SY+ Sbjct: 1038 THRRSQTLSPVRNERNYHTLTTTRTHSTERPFVAVQRAHDNAKLQTIGAREESFSSYR 1095 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 592 KKLYDINVAKVNTLIRPDG 648 K+LYD ++ N LIRP G Sbjct: 25 KRLYDDLLSNYNRLIRPVG 43 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 593,230 Number of Sequences: 2352 Number of extensions: 11718 Number of successful extensions: 35 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -