BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0396 (555 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25130| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_17112| Best HMM Match : Trypsin (HMM E-Value=0) 30 1.5 SB_35040| Best HMM Match : fn3 (HMM E-Value=0.016) 27 7.8 >SB_25130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 32.3 bits (70), Expect = 0.27 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 128 QCRNLRYPLRDHTSMGWRPVCLLPYFWHI 214 QC+N R P + ++ W CL P W + Sbjct: 232 QCKNSRIPSYEQATIAWATCCLTPNLWRV 260 >SB_17112| Best HMM Match : Trypsin (HMM E-Value=0) Length = 636 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -1 Query: 390 LDSFSSSPRDLGY*TSRLVTKDRCLP 313 + SF +SP+ LGY R VTK CLP Sbjct: 570 ISSFMASPQCLGYSHYRTVTKTICLP 595 >SB_35040| Best HMM Match : fn3 (HMM E-Value=0.016) Length = 442 Score = 27.5 bits (58), Expect = 7.8 Identities = 8/30 (26%), Positives = 18/30 (60%) Frame = +1 Query: 124 WSMPKFAISVERPYQYGVEACLSSTIFLAY 213 WS+P+ I+ P+++ E C+++ + Y Sbjct: 133 WSIPRKGITTLEPHEWSTEDCVNANKLIVY 162 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,397,071 Number of Sequences: 59808 Number of extensions: 381921 Number of successful extensions: 847 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 776 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 847 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1288581898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -