BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0396 (555 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83236-1|CAB05777.1| 445|Caenorhabditis elegans Hypothetical pr... 29 3.0 AC006723-5|AAK68424.1| 575|Caenorhabditis elegans Hypothetical ... 27 9.1 >Z83236-1|CAB05777.1| 445|Caenorhabditis elegans Hypothetical protein K10H10.1 protein. Length = 445 Score = 28.7 bits (61), Expect = 3.0 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -1 Query: 252 FWAYLISLLXSSRICQKYGRRQTGLHPILVWSL 154 FW Y ++ + + RI KYG + + L W++ Sbjct: 68 FWGYALTQVFAGRIADKYGAEKILPYSSLAWTM 100 >AC006723-5|AAK68424.1| 575|Caenorhabditis elegans Hypothetical protein Y19D10B.5 protein. Length = 575 Score = 27.1 bits (57), Expect = 9.1 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -3 Query: 178 PPHTGMVSQRISQISALTKAXLTECIFRVAFLMRVVNRSCSDIF 47 PPH+ MVS R S+I+ L C+ + + V C+D + Sbjct: 3 PPHSTMVSPRASKINGW--KTLLNCLQTIKCIQNVSLDPCNDFY 44 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,735,293 Number of Sequences: 27780 Number of extensions: 291137 Number of successful extensions: 524 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 524 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1134321766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -