BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0395 (546 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P34834 Cluster: ATP synthase a chain; n=182; Protostomi... 70 3e-11 UniRef50_Q53E88 Cluster: ATP synthase A chain; n=12; Arthropoda|... 64 2e-09 UniRef50_P00850 Cluster: ATP synthase a chain; n=75; Panarthropo... 60 2e-08 UniRef50_Q9MJE8 Cluster: ATP synthase A chain; n=28; Aphidiinae|... 51 2e-05 UniRef50_Q65Z32 Cluster: ATP synthase A chain; n=20; Bilateria|R... 50 3e-05 UniRef50_Q9B6H6 Cluster: ATP synthase a chain; n=31; Hemiptera|R... 50 3e-05 UniRef50_Q6SKY8 Cluster: ATP synthase A chain; n=2; Crustacea|Re... 49 6e-05 UniRef50_Q2F265 Cluster: ATP synthase A chain; n=32; Arthropoda|... 44 0.002 UniRef50_A7E1P8 Cluster: ATP synthase subunit 6; n=1; Achelia bi... 44 0.002 UniRef50_Q9TB90 Cluster: ATP synthase A chain; n=1; Circulifer t... 44 0.003 UniRef50_Q4FBR9 Cluster: ATP synthase A chain; n=10; Cyamus|Rep:... 42 0.012 UniRef50_Q37708 Cluster: ATP synthase a chain; n=19; Arthropoda|... 42 0.012 UniRef50_Q69HD3 Cluster: ATP synthase A chain; n=9; Pancrustacea... 40 0.038 UniRef50_Q00275 Cluster: ATP synthase a chain; n=6; Apidae|Rep: ... 39 0.066 UniRef50_Q535G8 Cluster: ATP synthase A chain; n=4; Araneae|Rep:... 39 0.087 UniRef50_Q8HQ02 Cluster: ATP synthase A chain; n=1; Thrips imagi... 36 0.61 UniRef50_Q535F6 Cluster: ATP synthase A chain; n=1; Endeis spino... 36 0.81 UniRef50_A0MG53 Cluster: ATP synthase A chain; n=1; Nymphon grac... 35 1.4 UniRef50_Q8HEI4 Cluster: ATP synthase A chain; n=2; Varroa destr... 33 5.7 UniRef50_Q674N6 Cluster: ATP synthase A chain; n=5; Aleyrodidae|... 33 5.7 UniRef50_Q2HJL0 Cluster: ATP synthase A chain; n=1; Campanulotes... 33 5.7 UniRef50_A7E1M1 Cluster: ATPase subunit 6; n=1; Aulostomus chine... 32 7.5 UniRef50_Q4W8D6 Cluster: ATP synthase A chain; n=3; Leptotrombid... 32 7.5 UniRef50_Q2KR23 Cluster: ATP synthase A chain; n=32; Lepeophthei... 32 7.5 UniRef50_A0EYM6 Cluster: ATP synthase A chain; n=2; Xenoturbella... 32 7.5 UniRef50_A0BG27 Cluster: Chromosome undetermined scaffold_105, w... 32 7.5 UniRef50_O99821 Cluster: ATP synthase a chain; n=10; Arthropoda|... 32 7.5 >UniRef50_P34834 Cluster: ATP synthase a chain; n=182; Protostomia|Rep: ATP synthase a chain - Anopheles gambiae (African malaria mosquito) Length = 226 Score = 70.1 bits (164), Expect = 3e-11 Identities = 33/60 (55%), Positives = 42/60 (70%) Frame = +2 Query: 74 MITNLFSIFDPSTNLINLPIN*IRTILGLLFIPYRF*LIPNRHFII*NFISKKLHNEFKT 253 M+TNLFS+FDPST ++NL +N + T LGL IP + L+PNR +I N I LH EFKT Sbjct: 1 MMTNLFSVFDPSTTILNLSLNWLSTFLGLFLIPVSYWLMPNRFQVIWNNILLTLHKEFKT 60 Score = 52.0 bits (119), Expect = 9e-06 Identities = 26/80 (32%), Positives = 35/80 (43%) Frame = +1 Query: 274 NGSTXXXXXXXXXXXXXXXXXXXPYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIF 453 NGST PYIFT T H YG I +T H+F Sbjct: 68 NGSTLMFISLFSLIMFNNFLGLFPYIFTSTSHLTLTLALAFPLWLSFMLYGWINHTQHMF 127 Query: 454 IHIIPQGXPYILIPFIVIMK 513 H++PQG P +L+PF+V ++ Sbjct: 128 AHLVPQGTPPVLMPFMVCIE 147 >UniRef50_Q53E88 Cluster: ATP synthase A chain; n=12; Arthropoda|Rep: ATP synthase A chain - Eriocheir sinensis (Chinese mitten crab) Length = 224 Score = 64.5 bits (150), Expect = 2e-09 Identities = 30/59 (50%), Positives = 42/59 (71%) Frame = +2 Query: 74 MITNLFSIFDPSTNLINLPIN*IRTILGLLFIPYRF*LIPNRHFII*NFISKKLHNEFK 250 M+TNLFSIF+PS+++ NL +N I TILGL+F+PY + P+R ++ I LH EFK Sbjct: 1 MMTNLFSIFEPSSSIFNLSMNWISTILGLMFLPYMYWASPSRWSLLWGKIISTLHKEFK 59 Score = 51.6 bits (118), Expect = 1e-05 Identities = 20/57 (35%), Positives = 33/57 (57%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 PY+FT + H +G IK+T H+F H++PQG P+ L+PF+V+++ Sbjct: 90 PYVFTSSSHMVMTLSLSLPLWITLMTFGWIKHTKHMFAHLVPQGTPFALMPFMVLIE 146 >UniRef50_P00850 Cluster: ATP synthase a chain; n=75; Panarthropoda|Rep: ATP synthase a chain - Drosophila melanogaster (Fruit fly) Length = 224 Score = 60.5 bits (140), Expect = 2e-08 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = +2 Query: 74 MITNLFSIFDPSTNLINLPIN*IRTILGLLFIPYRF*LIPNRHFII*NFISKKLHNEFKT 253 M+TNLFS+FDPS + N +N + T LGLL IP + L+P+R+ I+ N I LH EFKT Sbjct: 1 MMTNLFSVFDPSA-IFNFSLNWLSTFLGLLMIPSIYWLMPSRYNIMWNSILLTLHKEFKT 59 Score = 52.8 bits (121), Expect = 5e-06 Identities = 27/80 (33%), Positives = 35/80 (43%) Frame = +1 Query: 274 NGSTXXXXXXXXXXXXXXXXXXXPYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIF 453 NGST PYIFT T H YG I +T H+F Sbjct: 67 NGSTFIFISLFSLILFNNFMGLFPYIFTSTSHLTLTLSLALPLWLCFMLYGWINHTQHMF 126 Query: 454 IHIIPQGXPYILIPFIVIMK 513 H++PQG P IL+PF+V ++ Sbjct: 127 AHLVPQGTPAILMPFMVCIE 146 >UniRef50_Q9MJE8 Cluster: ATP synthase A chain; n=28; Aphidiinae|Rep: ATP synthase A chain - Lysiphlebus fabarum Length = 207 Score = 51.2 bits (117), Expect = 2e-05 Identities = 25/87 (28%), Positives = 40/87 (45%) Frame = +1 Query: 253 ILKNNYFNGSTXXXXXXXXXXXXXXXXXXXPYIFTRTRHXXXXXXXXXXXXXXXXXYG*I 432 ILKNN+ + PYIFT + H +G + Sbjct: 40 ILKNNFNMNNLLFYISLFMFILMNNFLGLFPYIFTSSSHLIYSLSLSLPMWLGLMIFGWV 99 Query: 433 KNTNHIFIHIIPQGXPYILIPFIVIMK 513 KNTN +F H++PQG P++L+ F+V+++ Sbjct: 100 KNTNFMFAHLVPQGTPFVLMFFMVLIE 126 >UniRef50_Q65Z32 Cluster: ATP synthase A chain; n=20; Bilateria|Rep: ATP synthase A chain - Caenorhabditis elegans Length = 221 Score = 50.4 bits (115), Expect = 3e-05 Identities = 21/57 (36%), Positives = 30/57 (52%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 PY FT T H YG + NT H+F H++P G P IL+PF+V+++ Sbjct: 88 PYTFTSTAHIAMTLSMALTIWLIFMIYGWVNNTKHMFAHLVPLGTPVILMPFMVLIE 144 >UniRef50_Q9B6H6 Cluster: ATP synthase a chain; n=31; Hemiptera|Rep: ATP synthase a chain - Rhopalosiphum padi (Bird cherry-oat aphid) Length = 217 Score = 50.4 bits (115), Expect = 3e-05 Identities = 23/42 (54%), Positives = 31/42 (73%) Frame = +2 Query: 74 MITNLFSIFDPSTNLINLPIN*IRTILGLLFIPYRF*LIPNR 199 M TNLF+IFDPST + NL +N I T+L +LF+P ++PNR Sbjct: 1 MTTNLFNIFDPSTTIFNLEMNWISTLLIILFMPNFLWILPNR 42 Score = 32.3 bits (70), Expect = 7.5 Identities = 16/62 (25%), Positives = 25/62 (40%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMKPSE 522 PYIF+ + H KNT ++ H+IP P L P + I++ Sbjct: 91 PYIFSSSSHMVFSVTLAIPFWMFFIILSTCKNTKNMIAHLIPLNTPIYLAPLMTIIETMS 150 Query: 523 IL 528 I+ Sbjct: 151 II 152 >UniRef50_Q6SKY8 Cluster: ATP synthase A chain; n=2; Crustacea|Rep: ATP synthase A chain - Speleonectes tulumensis Length = 223 Score = 49.2 bits (112), Expect = 6e-05 Identities = 27/60 (45%), Positives = 38/60 (63%) Frame = +2 Query: 74 MITNLFSIFDPSTNLINLPIN*IRTILGLLFIPYRF*LIPNRHFII*NFISKKLHNEFKT 253 M+TNLFS FDP+T + N+ +N I+ + L IP F +IP+R + N I+KKL E T Sbjct: 1 MMTNLFSTFDPTT-MNNMQMNWIQMMTPLFMIPSVFWMIPSRSNMTMNIITKKLSQEMST 59 Score = 38.7 bits (86), Expect = 0.087 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 PY FT T H Y IK +F H+IP G P +L+PF+V+++ Sbjct: 89 PYTFTSTTHLSITLSFALPMWLMPLMYLMIKKNQTLFSHMIPLGTPTLLMPFMVMIE 145 >UniRef50_Q2F265 Cluster: ATP synthase A chain; n=32; Arthropoda|Rep: ATP synthase A chain - Daphnia pulex (Water flea) Length = 224 Score = 44.4 bits (100), Expect = 0.002 Identities = 17/57 (29%), Positives = 30/57 (52%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 PY+FT + H YG + +T H+ H++P G P +L+PF+V+++ Sbjct: 90 PYVFTASSHLAMTLALAFPLWLAFILYGWLNHTTHMLAHLVPLGTPPVLMPFMVLIE 146 >UniRef50_A7E1P8 Cluster: ATP synthase subunit 6; n=1; Achelia bituberculata|Rep: ATP synthase subunit 6 - Achelia bituberculata Length = 222 Score = 44.0 bits (99), Expect = 0.002 Identities = 19/50 (38%), Positives = 34/50 (68%) Frame = +2 Query: 74 MITNLFSIFDPSTNLINLPIN*IRTILGLLFIPYRF*LIPNRHFII*NFI 223 M+ NLFS+FDP++NL+N+ +N I + ++F+ Y + L+ +R I N + Sbjct: 1 MMNNLFSVFDPTSNLLNIQLNWISMAIIIMFLYYNYWLMNSRFLKIINIM 50 Score = 41.1 bits (92), Expect = 0.016 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 PYIFT T H YG I T + H++P G P +L+PF+V+++ Sbjct: 88 PYIFTSTSHILITLSLALLLWISYYIYGWIMKTFMMLAHLVPIGTPLLLMPFMVLIE 144 >UniRef50_Q9TB90 Cluster: ATP synthase A chain; n=1; Circulifer tenellus|Rep: ATP synthase A chain - Circulifer tenellus (beet leafhopper) Length = 186 Score = 43.6 bits (98), Expect = 0.003 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 PYIFT + H +G TN +F H++P G P +L+PF+V+++ Sbjct: 67 PYIFTASAHLVFSLSLALTLWMSMMLFGWTNKTNSMFCHLVPTGTPNVLMPFMVLIE 123 >UniRef50_Q4FBR9 Cluster: ATP synthase A chain; n=10; Cyamus|Rep: ATP synthase A chain - Cyamus gracilis (Whale louse) Length = 223 Score = 41.5 bits (93), Expect = 0.012 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 P+ FT T H YG NT+++ +H++P G P +L+P +V+++ Sbjct: 88 PFTFTATAHMAVTVSMALPLWVALIIYGWSHNTSNLLVHLVPNGTPTVLMPLMVVIE 144 Score = 36.7 bits (81), Expect = 0.35 Identities = 19/59 (32%), Positives = 32/59 (54%) Frame = +2 Query: 74 MITNLFSIFDPSTNLINLPIN*IRTILGLLFIPYRF*LIPNRHFII*NFISKKLHNEFK 250 M+TNLFSIFDP+T+ +N + + +P F + R+ ++ N + + EFK Sbjct: 1 MMTNLFSIFDPATS-TTFAVNWLAAFTFMFVLPLSFWVTNQRYHLLLNKLINYITTEFK 58 >UniRef50_Q37708 Cluster: ATP synthase a chain; n=19; Arthropoda|Rep: ATP synthase a chain - Artemia sanfranciscana (Brine shrimp) (Artemia franciscana) Length = 219 Score = 41.5 bits (93), Expect = 0.012 Identities = 20/57 (35%), Positives = 27/57 (47%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 PYIFT T H Y IK T + H++P G P L+PF+V+M+ Sbjct: 87 PYIFTATSHLAVTLSLAVPLWISFILYTWIKETTNALAHLVPLGTPAPLMPFMVLME 143 Score = 33.1 bits (72), Expect = 4.3 Identities = 16/42 (38%), Positives = 29/42 (69%) Frame = +2 Query: 74 MITNLFSIFDPSTNLINLPIN*IRTILGLLFIPYRF*LIPNR 199 M+ +LFS+FDP+++ ++ N + ++ LLF+ F LIP+R Sbjct: 1 MMASLFSVFDPTSSFLS---NWLSMLIPLLFMVMSFWLIPSR 39 >UniRef50_Q69HD3 Cluster: ATP synthase A chain; n=9; Pancrustacea|Rep: ATP synthase A chain - Pachypsylla venusta (Hackberry petiole gall psyllid) Length = 224 Score = 39.9 bits (89), Expect = 0.038 Identities = 25/68 (36%), Positives = 39/68 (57%) Frame = +2 Query: 74 MITNLFSIFDPSTNLINLPIN*IRTILGLLFIPYRF*LIPNRHFII*NFISKKLHNEFKT 253 M+++LFS+FDPST+ N+ N + + L+FIP + + +R I LH EF + Sbjct: 1 MMSSLFSMFDPSTS-FNIQTNWLTMNIVLIFIPLTYWKLNSRISNSIKLIILSLHKEFIS 59 Query: 254 Y*KITILM 277 K +ILM Sbjct: 60 LFKYSILM 67 >UniRef50_Q00275 Cluster: ATP synthase a chain; n=6; Apidae|Rep: ATP synthase a chain - Apis mellifera ligustica (Common honeybee) Length = 226 Score = 39.1 bits (87), Expect = 0.066 Identities = 22/59 (37%), Positives = 35/59 (59%) Frame = +2 Query: 74 MITNLFSIFDPSTNLINLPIN*IRTILGLLFIPYRF*LIPNRHFII*NFISKKLHNEFK 250 ++ NLF +FDPST+ NL +N + +L ++ P F LI +R I + ++NEFK Sbjct: 5 LMMNLFEMFDPSTS-NNLSMNWLFMMLPIIIFPSIFWLIQSRIMFIMKTLMNFMYNEFK 62 >UniRef50_Q535G8 Cluster: ATP synthase A chain; n=4; Araneae|Rep: ATP synthase A chain - Argiope bruennichi (Wasp spider) Length = 223 Score = 38.7 bits (86), Expect = 0.087 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 P++FT T H G +KN H H++P+G P L P +VI++ Sbjct: 90 PFVFTSTAHPMITMGLGLVFWXSFFLMGWVKNFKHSAAHLVPEGSPIYLSPLMVIIE 146 >UniRef50_Q8HQ02 Cluster: ATP synthase A chain; n=1; Thrips imaginis|Rep: ATP synthase A chain - Thrips imaginis (Plague thrips) Length = 218 Score = 35.9 bits (79), Expect = 0.61 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 P FT T H +G K TN +F H++P G P LI F+V+++ Sbjct: 83 PNTFTPTSHISINMMISFPMWMGFMIFGWTKFTNKMFSHLVPSGTPMPLISFMVLIE 139 >UniRef50_Q535F6 Cluster: ATP synthase A chain; n=1; Endeis spinosa|Rep: ATP synthase A chain - Endeis spinosa Length = 221 Score = 35.5 bits (78), Expect = 0.81 Identities = 17/62 (27%), Positives = 27/62 (43%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMKPSE 522 PY+FT + H + K TN H++P G P L+P +V+++ S Sbjct: 87 PYVFTASTHMAFTLVIALIVWISINIFAWTKKTNLSLAHLVPMGTPAPLMPLMVLIETSS 146 Query: 523 IL 528 L Sbjct: 147 NL 148 Score = 33.1 bits (72), Expect = 4.3 Identities = 13/44 (29%), Positives = 31/44 (70%) Frame = +2 Query: 74 MITNLFSIFDPSTNLINLPIN*IRTILGLLFIPYRF*LIPNRHF 205 M+ N+FSIFDP+++++++ +N + I+ ++ +P + +PN + Sbjct: 1 MMNNMFSIFDPTSSILSIKLNWLIMIM-VMVVPSKKMWMPNSRY 43 >UniRef50_A0MG53 Cluster: ATP synthase A chain; n=1; Nymphon gracile|Rep: ATP synthase A chain - Nymphon gracile Length = 204 Score = 34.7 bits (76), Expect = 1.4 Identities = 15/39 (38%), Positives = 26/39 (66%) Frame = +2 Query: 83 NLFSIFDPSTNLINLPIN*IRTILGLLFIPYRF*LIPNR 199 NLF+ F+ S L NLP+ + ++ ++ +P +F LIP+R Sbjct: 3 NLFTNFNTSMELFNLPLKWMSILMIMMLMPNKFWLIPSR 41 >UniRef50_Q8HEI4 Cluster: ATP synthase A chain; n=2; Varroa destructor|Rep: ATP synthase A chain - Varroa destructor (honeybee mite) Length = 220 Score = 32.7 bits (71), Expect = 5.7 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 PY+FT T H +G N + H++P+G P L F+V+++ Sbjct: 88 PYVFTPTSHMSVTMSLSLSVWMTIMIFGWSNFFNKMMKHLVPEGTPIYLASFMVLIE 144 >UniRef50_Q674N6 Cluster: ATP synthase A chain; n=5; Aleyrodidae|Rep: ATP synthase A chain - Trialeurodes vaporariorum (greenhouse whitefly) Length = 217 Score = 32.7 bits (71), Expect = 5.7 Identities = 15/54 (27%), Positives = 24/54 (44%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIV 504 PY+F+ + H G + + +F H+IP G P +LIP +V Sbjct: 92 PYVFSSSSHLVYTMTLSFPAWLGLMLLGWCQFSKSMFSHLIPSGTPLLLIPLMV 145 >UniRef50_Q2HJL0 Cluster: ATP synthase A chain; n=1; Campanulotes bidentatus compar|Rep: ATP synthase A chain - Campanulotes bidentatus compar (small pigeon louse) Length = 229 Score = 32.7 bits (71), Expect = 5.7 Identities = 14/57 (24%), Positives = 25/57 (43%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 PY+FT + H Y K+ + H++P G P L+P +V+++ Sbjct: 96 PYVFTLSSHLCVNLSVSLVLWLGGVVYSMKKSMDSFLSHMVPLGSPVFLLPLLVLIE 152 >UniRef50_A7E1M1 Cluster: ATPase subunit 6; n=1; Aulostomus chinensis|Rep: ATPase subunit 6 - Aulostomus chinensis (Chinese trumpetfish) Length = 227 Score = 32.3 bits (70), Expect = 7.5 Identities = 14/62 (22%), Positives = 26/62 (41%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMKPSE 522 PYI+ T + G H H++P+G P L+PF+++++ Sbjct: 90 PYIYAPTSNMLITLGLAIPATIATISLGMRTQPAHALAHLVPEGSPMPLVPFLILIETMS 149 Query: 523 IL 528 +L Sbjct: 150 LL 151 >UniRef50_Q4W8D6 Cluster: ATP synthase A chain; n=3; Leptotrombidium|Rep: ATP synthase A chain - Leptotrombidium pallidum Length = 207 Score = 32.3 bits (70), Expect = 7.5 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 430 IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 IK T H H++P G P LIP +V+++ Sbjct: 108 IKKTKHFLSHLVPSGSPKGLIPLMVLIE 135 >UniRef50_Q2KR23 Cluster: ATP synthase A chain; n=32; Lepeophtheirus salmonis|Rep: ATP synthase A chain - Lepeophtheirus salmonis (salmon louse) Length = 217 Score = 32.3 bits (70), Expect = 7.5 Identities = 15/57 (26%), Positives = 26/57 (45%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 PYIFT + H + ++ F H++P+G P LIP +V+++ Sbjct: 82 PYIFTSSSHICVSLGMGLPLWLGSQTVCWVYSSEQSFAHLVPEGAPSGLIPLLVLIE 138 >UniRef50_A0EYM6 Cluster: ATP synthase A chain; n=2; Xenoturbella bocki|Rep: ATP synthase A chain - Xenoturbella bocki Length = 233 Score = 32.3 bits (70), Expect = 7.5 Identities = 14/62 (22%), Positives = 26/62 (41%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMKPSE 522 PY FT + H G T H++P+G P ++PF+++++ Sbjct: 96 PYTFTPSSHLALTMTLAIPLWSASIILGMRVKTKEAISHLLPEGTPLAIVPFMIMIETLS 155 Query: 523 IL 528 I+ Sbjct: 156 II 157 >UniRef50_A0BG27 Cluster: Chromosome undetermined scaffold_105, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_105, whole genome shotgun sequence - Paramecium tetraurelia Length = 1172 Score = 32.3 bits (70), Expect = 7.5 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 126 KFIKFVDGSKIENKFVIIFN*KLIFFFWLN 37 KF K VD + IEN +++FN + FWLN Sbjct: 282 KFEKVVDYTFIENNTLVVFNQNNVSIFWLN 311 >UniRef50_O99821 Cluster: ATP synthase a chain; n=10; Arthropoda|Rep: ATP synthase a chain - Rhipicephalus sanguineus (Brown dog tick) Length = 221 Score = 32.3 bits (70), Expect = 7.5 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = +1 Query: 343 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGXPYILIPFIVIMK 513 PY+FT + H + I N + H++P G P L F+VI++ Sbjct: 89 PYVFTSSSHLVFTMFLAFPFWMTFILFSLINKFNMVMAHLVPMGSPMALSFFMVIIE 145 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 353,724,350 Number of Sequences: 1657284 Number of extensions: 5478349 Number of successful extensions: 11925 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 11483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11911 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 35405708495 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -