BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0392 (622 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56905| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.00 SB_22380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 >SB_56905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 30.7 bits (66), Expect = 1.00 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = -2 Query: 279 DRLNILLYRARFLTKLLLKYTYRNITSKFNFIFQTQYLHIYKLTTANVFANKIT 118 D LN YR F T L K+ +R NF++ +Y +T + K+T Sbjct: 23 DSLNFNNYRYNFNTSRLCKHMFRQCRYNINFVYHIKYRAELDMTETDDLDFKVT 76 >SB_22380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = -2 Query: 234 LLLKYTYRNITSKFNFIFQTQYLHIYK--LTTANVFANKITGYYTIHSCTHTIAFYD 70 L+L++ + + NF+ QTQ H++K L+ + + G +++ S FYD Sbjct: 578 LVLEFYVNAVEAFVNFLSQTQANHLFKACLSLLDTYTKCNMGKHSLSSLVEEEQFYD 634 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,897,107 Number of Sequences: 59808 Number of extensions: 269045 Number of successful extensions: 445 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -