BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0392 (622 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U76402-1|AAB39734.1| 777|Caenorhabditis elegans degenerin protein. 28 6.2 U40798-3|AAA81473.2| 777|Caenorhabditis elegans Uncoordinated p... 28 6.2 >U76402-1|AAB39734.1| 777|Caenorhabditis elegans degenerin protein. Length = 777 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/63 (22%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = -3 Query: 260 YIEPDSLQNYC*NIHTEISLRNSISSFKRNIYTFINLQQLTYL-LIKLRAITLFIHVRTQ 84 +++P+ Y N + + L+NS + + +N+ Q Y+ + + L +H + Q Sbjct: 439 HVDPEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNVHQSDYMPTTEAAGVRLVVHEQDQ 498 Query: 83 LPF 75 PF Sbjct: 499 EPF 501 >U40798-3|AAA81473.2| 777|Caenorhabditis elegans Uncoordinated protein 8 protein. Length = 777 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/63 (22%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = -3 Query: 260 YIEPDSLQNYC*NIHTEISLRNSISSFKRNIYTFINLQQLTYL-LIKLRAITLFIHVRTQ 84 +++P+ Y N + + L+NS + + +N+ Q Y+ + + L +H + Q Sbjct: 439 HVDPEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNVHQSDYMPTTEAAGVRLVVHEQDQ 498 Query: 83 LPF 75 PF Sbjct: 499 EPF 501 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,371,306 Number of Sequences: 27780 Number of extensions: 228230 Number of successful extensions: 484 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 484 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1353389824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -