BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0391 (605 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. 24 3.3 AY752902-1|AAV30076.1| 106|Anopheles gambiae peroxidase 8 protein. 23 5.8 >DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. Length = 434 Score = 24.2 bits (50), Expect = 3.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 363 YKQIDSELLEKYIYTKRNFSLLLI 292 YK++D+++LE R S+LLI Sbjct: 261 YKELDAQILELPYGANRRLSMLLI 284 >AY752902-1|AAV30076.1| 106|Anopheles gambiae peroxidase 8 protein. Length = 106 Score = 23.4 bits (48), Expect = 5.8 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 58 NRYPHLSSMAIKIRKENNRILFSVGSF-LILRNKNVY 165 N+ PHL+ + +E+NRI + F L N+ V+ Sbjct: 6 NQSPHLAILQTAFVREHNRIALDIQRFNRNLSNEEVF 42 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 636,576 Number of Sequences: 2352 Number of extensions: 11852 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -