BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0387 (630 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_08_0023 + 27741775-27742475,27744163-27744413,27744557-277447... 28 7.0 12_01_1092 - 11362094-11362367,11362739-11362795,11363256-113636... 27 9.3 >11_08_0023 + 27741775-27742475,27744163-27744413,27744557-27744715, 27744976-27745409,27745537-27746076 Length = 694 Score = 27.9 bits (59), Expect = 7.0 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = +2 Query: 455 YMIKILYTIQFIYYSIILSCLYTTRKSNKFSNTK--RLFKS-NLIFTF*SDL 601 Y++ L T+ + +L CLY RK F+N RL K N++ DL Sbjct: 365 YIVPTLATVCSVISLTVLVCLYKRRKRRMFANNNGGRLLKDMNIVLITEKDL 416 >12_01_1092 - 11362094-11362367,11362739-11362795,11363256-11363683, 11364350-11365462 Length = 623 Score = 27.5 bits (58), Expect = 9.3 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = -1 Query: 183 LIFLTRRYFFTVEVNH*RFLSAYFIRKTCLRDLNTGTAASLGMNALGFLSFRPRR 19 +I + R YF+ E R+ ++ K+ RDL + ASL L PR+ Sbjct: 153 VIPVVRTYFYVTERESKRY-DVFYYPKSVWRDLTSNAIASLNKKNFRILRGEPRK 206 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,848,416 Number of Sequences: 37544 Number of extensions: 272254 Number of successful extensions: 466 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 466 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1537558360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -